Redefine origin inventor jobs

Filtrer

Mes recherches récentes
Filtrer par :
Budget
à
à
à
Type
Compétences
Langues
    État du travail
    8,577 redefine origin inventor travaux trouvés au tarif de EUR

    Afin de nous accompagner dans la forte demande que nous avons actuellement, nous recherchons un(e) dessinateur Autocad 3D Inventor afin de traduire les plans de l'architecte en plan de production. Nous construisons des bâtiments modulaires en ossature métallique.

    €477 (Avg Bid)
    €477 Offre moyenne
    20 offres

    ...bouteilles de verre venant d'Italie et je souhaite créer l'autocollant qui sera collé à la bouteille. J'ai déjà le nom du produit : Origin , et une idée comment ça pourrait s'afficher (cf pièces jointe) le O dans Origin devrait ressembler à une olive. L'affiche doit être simple pas e...

    €31 (Avg Bid)
    €31 Offre moyenne
    3 offres

    ...zéro. - le joueur gagne ET perd des points de différentes façons. Vous pouvez partir du projet de base vu en séminaire « BallBounceGame » Il faut utiliser la version app inventor gratuite pour réaliser ce projet Il faut créer deux jeux: un morpion ( ronds,croix) Un memory Les jeux doivent &ec...

    €25 - €212
    €25 - €212
    0 offres

    ...projet est scindé en 5 grands volets (voir [login to view URL]). Nous avons lancé déjà le volet 1er Volet : « Swiss made ou Total Transparency on Origin ». Chaque volet sera créer de la même manière : Teaser -> Vidéo -> Article -> Diffusion global Nous créons le contenu (textes et visuels) mais nous...

    €18 / hr (Avg Bid)
    €18 / hr Offre moyenne
    3 offres

    ...et elle doit retourner un résultat de type JSON en autorisant la possibilité d’être consultée depuis un nom de domaine différent, c'est-à-dire autoriser les requêtes cross origin. Dans ce document, je vais utiliser un lien comme exemple qui pourra être changé par la suite, ce dernier va représenter le chemin ve...

    €286 (Avg Bid)
    €286 Offre moyenne
    3 offres

    Bonjour, J'envisage de développer une version terrestre d...télésiège-monorail [login to view URL] J'ai besoin d'un appuis en ingénierie: design et dimensionnement du support et des éléments de roulement pour la partie rail + mobile. CAO/DAO: Autodesk Inventor 2015 Merci de me dire si vous êtes intéressé par...

    €17 / hr (Avg Bid)
    €17 / hr Offre moyenne
    1 offres
    Trophy icon Wine Farm & Bottle LOGOTYPE 8 days left

    ...next to a brook and with a water mill. Type of production: High quality red and white wine: WHAT WE ARE LOOKING FOR: A logo concept that translates the ancient origin and past of the farm, allied to its location and that is based on the structuring of the idea considering the following 4 points: Wine; Brook; Water Mill; Royals

    €80 (Avg Bid)
    Garanti Meilleur concours
    €80
    14 propositions

    The website is mainly a repository and incident tracker of news all around the world. It provides the client of a way to both read the news and s...Project Proposal'. also I've attached herewith a sample of the map screenshot that shows the risk level of certain countries in some way. Icons should be added to pinpoint the origin of the stored news.

    €457 (Avg Bid)
    €457 Offre moyenne
    92 offres

    [login to view URL] i need Name , Title, Company name ,And linkedin Url 1500 need budge $4

    €2 / hr (Avg Bid)
    €2 / hr Offre moyenne
    28 offres

    Hello, Looking for someone in Newcastle NSW who can teach me autodesk inventor assembly and sheetmetal for fabrication projects

    €272 (Avg Bid)
    €272 Offre moyenne
    10 offres

    ...calendarized services. - For Users: ** Include payment method and save it (credit card or paypal). - Select type of Service: Motorcycle, Car, pick up, truck. - Select Origin and Destiny on geoMap. - Add instructions, message and photos. - Select immediately service or calendar a pick up date. - When selecting Pick up truck or truck, select

    €7167 (Avg Bid)
    €7167 Offre moyenne
    100 offres
    Discourse Plugin Update 4 days left
    VERIFIÉ

    ...- Shows - Already up-to-date. (not pulling any information) Then when i rebuild it fails ./launcher rebuild app Error is below Ensuring launcher is up to date Fetching origin Launcher is up-to-date Stopping old container /usr/bin/docker stop -t 10 app app cd /pups && git pull && /pups/bin/pups --stdin Already up-to-date. I, [2018-09-23T06:07:01

    €31 (Avg Bid)
    €31 Offre moyenne
    4 offres

    I need someone who is a specialist in speed optimization for shopify to make this site fast and must edit code. Attached is a report th...Defer offscreen images 3. Minify CSS Potential 4. Minify JavaScript 5. Defer unused CSS 6. Serve images in next-gen formats 7. Avoid multiple, costly round trips to any origin 8. Preload key requests Potential

    €133 (Avg Bid)
    €133 Offre moyenne
    5 offres
    Techninal writer 3 days left

    I am a local inventor that needs a technical writer to draft a technical paper about my product.

    €105 (Avg Bid)
    €105 Offre moyenne
    25 offres

    Estamos desarrollando nuevo software de configuración para nuestros clientes.

    €27 / hr (Avg Bid)
    €27 / hr Offre moyenne
    3 offres

    ...sequences. Discuss your answer. (5 marks) Question 3 (a) Solve the identity of the below sequence. Document the steps used to identify the sequence. Name the gene and the origin organism. MDWTWILFLVAAATRVHSTSMDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIRDA YLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSA DRGLVLMPG

    €55 (Avg Bid)
    €55 Offre moyenne
    7 offres

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located after the text "Origin:", before the first comma origin_state --> data located after the text "Origin:", after the first comma ship_date --> data located after the text "Pickup Date", changed to the YYYY-MM-DD...

    €111 (Avg Bid)
    €111 Offre moyenne
    14 offres

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located in the "ORIGIN CITY" column origin_state --> data located in the "ST" column to the right of the "ORIGIN CITY" column ship_date --> data located in the "PICKUP DATE" column changed to the YYYY-MM-DD for...

    €119 (Avg Bid)
    €119 Offre moyenne
    15 offres
    Trophy icon Logo for a Japanese Product 2 days left

    We want a get a logo redesigned to give it a traditional look. The inherent characteristics should be business like and professional with a Japanese origin. The brand is used to market chemicals and pigments in the international markets. The logo has to be of single colour, rusty and traditional. We should be able to screen print the logo on bags and

    €41 (Avg Bid)
    Garanti
    €41
    34 propositions

    ...In other words, since the arrow head of the arrow marker is aligned with the x-axis of this marker, we need the x-axis of the arrow coordinate frame to point directly at the origin of the cylinder coordinate frame. (Hint: Use the cross product to define the axis of rotation, and the dot product to infer the required rotation angle.) In the provided startup

    €31 (Avg Bid)
    €31 Offre moyenne
    4 offres

    ...- 502 (Bad Gateway) :8100/#/checkout/inicio/product:1 Failed to load -------------------------------------------------: No 'Access-Control-Allow-Origin' header is present on the requested resource. Origin 'http://localhost:8100' is therefore not allowed access. The response had HTTP status code 502. If an opaque response serves your needs, set the request'...

    €92 (Avg Bid)
    €92 Offre moyenne
    16 offres

    ...page form the 4 hexagon & link to the relavent page when user click the button
- newsletter subscription - social media integration • Learning - Input content “symptoms” & “origin” will show the info when user click the text - input ppt , when user click the ppt, will show the ppt on new tab & allow user to save & download the ppt - Will crea...

    €485 (Avg Bid)
    €485 Offre moyenne
    27 offres

    ...v=l4tq_eGp16A for an example I prefer that are you skillfull in autodesk software I give you a 3D model created in inventor 2018. I am searching also a expert designer of inventor in special case when i have no time for drawing inventor model. Now i'm searching to know some collaborators, the work starts from 2 weeks so we discuss of money from 2 weeks

    €435 (Avg Bid)
    €435 Offre moyenne
    49 offres
    Build a mobile game 23 hours left

    Want to build a game like clash of clans but with Indian theme. The characters would be from Indian Mythology and from comics related to Indian Origin. Game should work in different platforms(Android & IOS).

    €7 / hr (Avg Bid)
    €7 / hr Offre moyenne
    6 offres

    ...Employment Opportunity employer that does not discriminate against any associate or applicant on the basis of race, creed, color, religion, sex (including pregnancy), age, national origin, physical or mental disability, sexual orientation, marital or familial status, genetic information or other basis protected by law ...

    €132 (Avg Bid)
    €132 Offre moyenne
    1 offres

    Hello I have a 3D model metal construction. I need to make documentation for the workers. To create an Assembly in SolidWorks or inventor It should contain: 1) Assembly drawing (General and major subassemblies) 2) part Numbers. 3) in the drawing content isometric view and all dimensions of the part 4) Material specification name, part number, size

    €25 (Avg Bid)
    €25 Offre moyenne
    102 offres

    We are a successful company looking to employ talented individuals on our team who are self-motivated, positive and energetic....opportunity employer. Qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability or protected veteran status.

    €461 (Avg Bid)
    €461 Offre moyenne
    20 offres

    I need to make a 3D model that is printable . It’s a soda fountain machine . In this link, it is made by cardboard .. i wanna make a 3d model of same model sinc i am doing the same project.

    €108 (Avg Bid)
    €108 Offre moyenne
    24 offres

    ...family 9) Give the comparative and superlative forms of adjectives 10) Give the past tense and participle forms of verbs 11) Tell the syllable of a word to stress 12) Tell the origin of some foreign words 13) Give the meanings of useful phrases 14) Tell the level of usage of a certain word 15) Tell whether a certain word is a slang word, a taboo word, a

    €337 (Avg Bid)
    €337 Offre moyenne
    21 offres

    ...your Doctor and he treats you the conventional way, and treats only the symptoms and, might be missing smaller things such as the origin of your dis-ease? But what exactly is symptomatic treatment? What defines the origin of dis-ease? Imagine living at the bottom of a stream of water which is your life source, and suddenly you realize that this source

    €107 (Avg Bid)
    €107 Offre moyenne
    38 offres

    Hi, I want to scrap this site: [login to view URL] I need only 3 column brand, status, origin. No manual scrape only automatic scrape. Please check and bid if you can do this fast. Thanks

    €19 (Avg Bid)
    €19 Offre moyenne
    22 offres

    You can spend a clever way on advertising for $ 215, so that you meet the needs of everyday people by seeing t...clever way on advertising for $ 215, so that you meet the needs of everyday people by seeing the advertiser's needs, such as tips on how to buy cheap from a cheap place and the origin of goods and delivery at the buyer's preferred location.

    €25 (Avg Bid)
    €25 Offre moyenne
    1 offres

    I am an inventor. I'm looking to develop a photo booth app that people can use at event, weddings, etc. The app would only be for use with an iPad. It would mainly be a selfie app that captures photo and animated gifs. The app would have photo filters and themes. After a photo/gif has been taken, the app would have the ability to share the photos/gifs

    €2182 (Avg Bid)
    €2182 Offre moyenne
    148 offres

    ...want our about us text to show 3) we want on the home page some pictures and text boxes, 4 of these would be wonderful, off set (___)(.._...) (......)(...) 4) for the site origin plugin to work so we can do drop in place work or another click and play plugin 5) we wish for shops api to be showing ( so people can locate stores) 6) a points reward scheme

    €180 (Avg Bid)
    €180 Offre moyenne
    57 offres

    Helping in constraints some parts at the inventor

    €136 (Avg Bid)
    €136 Offre moyenne
    33 offres

    ...qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, gender expression, national origin, age, protected veteran or disabled status, or genetic information....

    €9 / hr (Avg Bid)
    €9 / hr Offre moyenne
    52 offres

    I need letter writing services offering my invention /product to a pertential buyer.

    €98 (Avg Bid)
    €98 Offre moyenne
    35 offres

    Hello, my name is Wyatt and I am an aspiring inventor/entrepreneur. I am currently seeking a product development engineer who can touch up some key points of my invention, and/or bring more efficient ideas to the table. The biggest factor is an engineer who knows how to implement mechanical joints into my product. This project will not be large and

    €129 (Avg Bid)
    €129 Offre moyenne
    44 offres

    ...the agreed mode of transportation. 3. Review of Documents: 3.1. The related required documents (such as the Packing List, Certificate of Conformity, Certificate of Origin, Test Certificates & etc.). Freelancer has to take photos from each step. Inspection date : 06.09.2018 - Morning 4. Prepare inspection report....

    €110 (Avg Bid)
    Local
    €110 Offre moyenne
    2 offres

    Popular Categories Get started with our popular courses and redefine your career MOBILE APP DEVELOPMENT Lorem ipsum dolor sit amet, con sectetur adipisi cing elit, sed do eius mod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam... LEARN MORE WEB DEVELOPMENT Lorem ipsum dolor sit amet, con sectetur adipisi cing elit, sed

    €14 (Avg Bid)
    €14 Offre moyenne
    3 offres

    I have a 2d plan of a drilling machine in pdf format. I am needing it to be digitized in Autodesk Inventor.

    €127 (Avg Bid)
    €127 Offre moyenne
    91 offres

    I have a script for a three page comic book named "Defenders of the Worlds Nation: Rise of...three page comic book named "Defenders of the Worlds Nation: Rise of Captain Eagle". It's possibly the start of a larger story. The three pages are part of the main heroes origin story. Included is the script so people can read it and know what it is I want.

    €137 (Avg Bid)
    €137 Offre moyenne
    30 offres

    Hi I am looking for an assignment based on flight booking and adding flight data to make them searchable. I need it in 72 hrs payment will be 6000 rupees indian.

    €54 (Avg Bid)
    €54 Offre moyenne
    6 offres

    I am Tianne Brown C.E.O. of 50 Is The New Sexy a company that looks to redefine the myths that surround the aging consumer and aging in general. I am looking for a researcher that is able to collect the statistics and data of the buying power, online shopping habits, time spent online what are the 20 year projections and forward trends of this demographic

    €303 (Avg Bid)
    €303 Offre moyenne
    22 offres

    ...is a row without an origin city, skip that row. Data will be listed in blocks with different contact information for each block, contact information will be located above the block of data. The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located in the "Load Origin" column before the ,

    €129 (Avg Bid)
    €129 Offre moyenne
    18 offres

    ...courier” page and provide their delivery requirements to search for other users who have posted their trips and users who’s last known location was in close vicinity to the origin point of the delivery request. We have a prototype ready, please message us for link to the prototype :)...

    €204 (Avg Bid)
    €204 Offre moyenne
    6 offres

    I am COO of a medical device company founded by the device inventor. Our device helps cancer patients undergoing chemo treatments. I am looking for a writer to interview the inventor, who is a cancer survivor and write his story for various cancer blogs and magazines.

    €786 (Avg Bid)
    €786 Offre moyenne
    46 offres

    ...Rackspace. Cloudflare. Amazon's AWS. EdgeCast/Verizon. Fastly. Looking for this features: General Features: HTTP/2 HPACK Compression (Huffman Encoding) GZip compression Cross-Origin Resource Sharing (CORS) Use your CNAMEs Force downloads Custom expire headers Live tail on your logs Raw log forwarding in real time Custom rules Byte-range requests

    €10366 (Avg Bid)
    €10366 Offre moyenne
    30 offres