Atos origin gateway jobs

Filtrer

Mes recherches récentes
Filtrer par :
Budget
à
à
à
Type
Compétences
Langues
    État du travail
    6,238 atos origin gateway travaux trouvés au tarif de EUR

    ...Nous choisirons un template de base Magento 2, mais il faut adapter les blocs, colonne, menus... et également envisager le paiement sécurisé, soit avec la solution actuelle ATOS SIPS, soit si c'est plus simple une solution Paylib, Payline... Je vous remercie,...

    €2379 (Avg Bid)
    €2379 Offre moyenne
    31 offres

    Bonjour DeveloppeurTop, comme convenue donc finir le projet me permettant...convenue donc finir le projet me permettant d'enregistré les modifications à l'intérieur de mes produits et d'ajouté mes produits sans soucis. Et de comme convenue de me mettre ATOS le payement en ligne également actif ( je vous fournirai la clé d'activat...

    €105 (Avg Bid)
    €105 Offre moyenne
    1 offres

    Bonjour, Je cherche quelqu'un pouvant m'implementer le moyen de payement atos sur mon site. Merci de me contacter pour plus d'information.

    €481 (Avg Bid)
    LDN
    €481 Offre moyenne
    4 offres

    Bonjour, Je cherche quelqu'un pouvant m'implementer le moyen de payement atos sur mon site. Merci de me contacter pour plus d'information.

    €448 (Avg Bid)
    Urgent LDN
    €448 Offre moyenne
    5 offres

    Lors du paiement l'erreur suivante s'est produite dans le chiffrement (cryptage) de la requete Erreur = Verifier les chemins dans le module ATOS, les fichiers et les autorisations dans le dossier ATOS, les fichiers request et response doivent etre des executables et avoir les permissions d'execution L'erreur s'est produite dans cette page (//

    €21 (Avg Bid)
    €21 Offre moyenne
    4 offres

    ...bouteilles de verre venant d'Italie et je souhaite créer l'autocollant qui sera collé à la bouteille. J'ai déjà le nom du produit : Origin , et une idée comment ça pourrait s'afficher (cf pièces jointe) le O dans Origin devrait ressembler à une olive. L'affiche doit être simple pas e...

    €31 (Avg Bid)
    €31 Offre moyenne
    3 offres

    ...projet est scindé en 5 grands volets (voir [login to view URL]). Nous avons lancé déjà le volet 1er Volet : « Swiss made ou Total Transparency on Origin ». Chaque volet sera créer de la même manière : Teaser -> Vidéo -> Article -> Diffusion global Nous créons le contenu (textes et visuels) mais nous...

    €18 / hr (Avg Bid)
    €18 / hr Offre moyenne
    3 offres

    Bonjour, Nous souhaitons un module (sans cryptage) de WHMCS pour une passerelle de paiement ATOS

    €220 (Avg Bid)
    €220 Offre moyenne
    1 offres

    ...et elle doit retourner un résultat de type JSON en autorisant la possibilité d’être consultée depuis un nom de domaine différent, c'est-à-dire autoriser les requêtes cross origin. Dans ce document, je vais utiliser un lien comme exemple qui pourra être changé par la suite, ce dernier va représenter le chemin ve...

    €286 (Avg Bid)
    €286 Offre moyenne
    3 offres

    Bonjour, Le projet consiste à créer un mini site qui sera complémentaire d'un site...normal-client professionnel gérer les paiements en ligne pour s'inscrire à un service d'assurance proposé par le site gérer les historiques intégration la solution de paiement (SIPS-ATOS) et paylib plus de détails à...

    €236 (Avg Bid)
    €236 Offre moyenne
    9 offres
    Discourse Plugin Update 6 days left
    VERIFIÉ

    ...- Shows - Already up-to-date. (not pulling any information) Then when i rebuild it fails ./launcher rebuild app Error is below Ensuring launcher is up to date Fetching origin Launcher is up-to-date Stopping old container /usr/bin/docker stop -t 10 app app cd /pups && git pull && /pups/bin/pups --stdin Already up-to-date. I, [2018-09-23T06:07:01

    €31 (Avg Bid)
    €31 Offre moyenne
    4 offres

    I need someone who is a specialist in speed optimization for shopify to make this site fast and must edit code. Attached is a report th...Defer offscreen images 3. Minify CSS Potential 4. Minify JavaScript 5. Defer unused CSS 6. Serve images in next-gen formats 7. Avoid multiple, costly round trips to any origin 8. Preload key requests Potential

    €133 (Avg Bid)
    €133 Offre moyenne
    5 offres

    ...learn more, visit aerotek.com. The company is an equal opportunity employer and will consider all applications without regards to race, sex, age, color, religion, national origin, veteran status, disability, sexual orientation, gender identity, genetic information or any characteristic protected by law. Job Overview: Global Electronic Distribution

    €28 / hr (Avg Bid)
    €28 / hr Offre moyenne
    28 offres

    Pa...PatronArt provides equal employment opportunities with consideration to an inclusive and innovative environment, without regard to race, color, religion, gender, age, national origin, disability, sexual orientation, gender identity, veteran status or any other protected status in accordance with applicable law. PatronArt participates in E-verify

    €15 (Avg Bid)
    €15 Offre moyenne
    4 offres

    ...sequences. Discuss your answer. (5 marks) Question 3 (a) Solve the identity of the below sequence. Document the steps used to identify the sequence. Name the gene and the origin organism. MDWTWILFLVAAATRVHSTSMDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIRDA YLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSA DRGLVLMPG

    €55 (Avg Bid)
    €55 Offre moyenne
    7 offres

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located after the text "Origin:", before the first comma origin_state --> data located after the text "Origin:", after the first comma ship_date --> data located after the text "Pickup Date", changed to the YYYY-MM-DD...

    €111 (Avg Bid)
    €111 Offre moyenne
    14 offres

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located in the "ORIGIN CITY" column origin_state --> data located in the "ST" column to the right of the "ORIGIN CITY" column ship_date --> data located in the "PICKUP DATE" column changed to the YYYY-MM-DD for...

    €123 (Avg Bid)
    €123 Offre moyenne
    13 offres
    Trophy icon Logo for a Japanese Product 4 days left

    We want a get a logo redesigned to give it a traditional look. The inherent characteristics should be business like and professional with a Japanese origin. The brand is used to market chemicals and pigments in the international markets. The logo has to be of single colour, rusty and traditional. We should be able to screen print the logo on bags and

    €41 (Avg Bid)
    Garanti
    €41
    33 propositions

    ...In other words, since the arrow head of the arrow marker is aligned with the x-axis of this marker, we need the x-axis of the arrow coordinate frame to point directly at the origin of the cylinder coordinate frame. (Hint: Use the cross product to define the axis of rotation, and the dot product to infer the required rotation angle.) In the provided startup

    €26 (Avg Bid)
    €26 Offre moyenne
    4 offres

    ... POST -------------------------------------------------------------- 502 (Bad Gateway) :8100/#/checkout/inicio/product:1 Failed to load -------------------------------------------------: No 'Access-Control-Allow-Origin' header is present on the requested resource. Origin 'http://localhost:8100' is therefore not allowed access. The response had HTTP

    €92 (Avg Bid)
    €92 Offre moyenne
    16 offres

    ...page form the 4 hexagon & link to the relavent page when user click the button
- newsletter subscription - social media integration • Learning - Input content “symptoms” & “origin” will show the info when user click the text - input ppt , when user click the ppt, will show the ppt on new tab & allow user to save & download the ppt - Will crea...

    €486 (Avg Bid)
    €486 Offre moyenne
    27 offres

    Want to build a game like clash of clans but with Indian theme. The characters would be from Indian Mythology and from comics related to Indian Origin. Game should work in different platforms(Android & IOS).

    €7 / hr (Avg Bid)
    €7 / hr Offre moyenne
    5 offres

    ...Employment Opportunity employer that does not discriminate against any associate or applicant on the basis of race, creed, color, religion, sex (including pregnancy), age, national origin, physical or mental disability, sexual orientation, marital or familial status, genetic information or other basis protected by law ...

    €132 (Avg Bid)
    €132 Offre moyenne
    1 offres

    We are a successful company looking to employ talented individuals on our team who are self-motivated, positive and energetic....opportunity employer. Qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability or protected veteran status.

    €464 (Avg Bid)
    €464 Offre moyenne
    18 offres

    ...family 9) Give the comparative and superlative forms of adjectives 10) Give the past tense and participle forms of verbs 11) Tell the syllable of a word to stress 12) Tell the origin of some foreign words 13) Give the meanings of useful phrases 14) Tell the level of usage of a certain word 15) Tell whether a certain word is a slang word, a taboo word, a

    €338 (Avg Bid)
    €338 Offre moyenne
    21 offres

    ...your Doctor and he treats you the conventional way, and treats only the symptoms and, might be missing smaller things such as the origin of your dis-ease? But what exactly is symptomatic treatment? What defines the origin of dis-ease? Imagine living at the bottom of a stream of water which is your life source, and suddenly you realize that this source

    €107 (Avg Bid)
    €107 Offre moyenne
    37 offres

    Hi, I want to scrap this site: [login to view URL] I need only 3 column brand, status, origin. No manual scrape only automatic scrape. Please check and bid if you can do this fast. Thanks

    €19 (Avg Bid)
    €19 Offre moyenne
    22 offres

    You can spend a clever way on advertising for $ 215, so that you meet the needs of everyday people by seeing t...clever way on advertising for $ 215, so that you meet the needs of everyday people by seeing the advertiser's needs, such as tips on how to buy cheap from a cheap place and the origin of goods and delivery at the buyer's preferred location.

    €26 (Avg Bid)
    €26 Offre moyenne
    1 offres

    ...want our about us text to show 3) we want on the home page some pictures and text boxes, 4 of these would be wonderful, off set (___)(.._...) (......)(...) 4) for the site origin plugin to work so we can do drop in place work or another click and play plugin 5) we wish for shops api to be showing ( so people can locate stores) 6) a points reward scheme

    €180 (Avg Bid)
    €180 Offre moyenne
    57 offres

    ...qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, gender expression, national origin, age, protected veteran or disabled status, or genetic information....

    €9 / hr (Avg Bid)
    €9 / hr Offre moyenne
    52 offres

    ...the agreed mode of transportation. 3. Review of Documents: 3.1. The related required documents (such as the Packing List, Certificate of Conformity, Certificate of Origin, Test Certificates & etc.). Freelancer has to take photos from each step. Inspection date : 06.09.2018 - Morning 4. Prepare inspection report....

    €110 (Avg Bid)
    Local
    €110 Offre moyenne
    2 offres

    I have a script for a three page comic book named "Defenders of the Worlds Nation: Rise of...three page comic book named "Defenders of the Worlds Nation: Rise of Captain Eagle". It's possibly the start of a larger story. The three pages are part of the main heroes origin story. Included is the script so people can read it and know what it is I want.

    €137 (Avg Bid)
    €137 Offre moyenne
    30 offres

    ...is a row without an origin city, skip that row. Data will be listed in blocks with different contact information for each block, contact information will be located above the block of data. The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located in the "Load Origin" column before the ,

    €129 (Avg Bid)
    €129 Offre moyenne
    18 offres

    ...courier” page and provide their delivery requirements to search for other users who have posted their trips and users who’s last known location was in close vicinity to the origin point of the delivery request. We have a prototype ready, please message us for link to the prototype :)...

    €204 (Avg Bid)
    €204 Offre moyenne
    6 offres

    ...Rackspace. Cloudflare. Amazon's AWS. EdgeCast/Verizon. Fastly. Looking for this features: General Features: HTTP/2 HPACK Compression (Huffman Encoding) GZip compression Cross-Origin Resource Sharing (CORS) Use your CNAMEs Force downloads Custom expire headers Live tail on your logs Raw log forwarding in real time Custom rules Byte-range requests

    €10381 (Avg Bid)
    €10381 Offre moyenne
    30 offres

    ...example writing work - word doc Resources - you will be provided with the following information. the 300 companies to include. Their names, their websites, the country of origin, the Headquarter location, business description, business category. Example intro. This article may interest investors, suppliers and job-seekers. We hope you will be as

    €126 (Avg Bid)
    LDN
    €126 Offre moyenne
    17 offres

    Additional variations on logo for Origin Sustainable Design + Planning

    €32 (Avg Bid)
    €32 Offre moyenne
    1 offres

    Use getdata to extract data form the given graphn and re-plotted by origin lab according to desire demand. Prodect budjet 5 USD. Work Description is given in the attached file. Simple work, so please bid those people who can understand easily. No time waster please.

    €9 (Avg Bid)
    €9 Offre moyenne
    2 offres

    ...3 digit speed display with 1 mph increments. Continuous display of straight line distance from origin: 0.0 to 9.9 miles maximum distance. 2 digit display with 0.1 mile increments. Maximum speed is retrieved by a push button (Hold to display) Origin and peak speed reset by another push button (Hold 10 seconds to reset) Change display units from

    €653 (Avg Bid)
    €653 Offre moyenne
    28 offres
    Trophy icon Design a Banner Ended

    We need to design a banner for our website to highlight that our products are origin from Malaysia, not China. Many of our customers don't make a difference between Malaysia and China, as a result the recent trade war between China and the US has turned many US customers away from us who are afraid of import problems. We need banner that will tell

    €43 (Avg Bid)
    Garanti
    €43
    75 propositions

    Need a modern corporate logo. Concept origin with Lotus Sutra >> [login to view URL] But the visual reference related to lotus flower in flat. Field of Business is related to Media Technologies, Entertainment, OTT, Audio And Video post-production. Visual Concept is a flat vector with very limited color shade except for color

    €53 (Avg Bid)
    €53 Offre moyenne
    70 offres

    The task is to build a webpage that shows a list of books - data is provided via an Ajax Request, that returns a JS...provided via an Ajax Request, that returns a JSON object. Note?: not a real server is needed here, the ajax call will return JSON files, you can serve it locally or from remote origin, or from google books api. It should be in react.

    €125 (Avg Bid)
    €125 Offre moyenne
    47 offres

    I need a very excellent 4 pages with authentic references about the meaning of evil including (meaning in dictionary + origin of evil (Eve and Adam) + theological meaning (in Christianity, Judaism, Hinduism, Islam, Chinese)>> and I need quotes from every religion and with MLA style.

    €106 (Avg Bid)
    €106 Offre moyenne
    39 offres

    ...data will be hosted within our website backend and have other data attached to it, which is not relevant to the search. The data we pull from amazon should be linked back into origin data. Also - On our site we have products. Each product has data from amazon that is constantly changing. In addition to possible match items process, we would also want

    €47 / hr (Avg Bid)
    €47 / hr Offre moyenne
    2 offres

    ...data will be hosted within our website backend and have other data attached to it, which is not relevant to the search. The data we pull from amazon should be linked back into origin data. Also - On our site we have products. Each product has data from amazon that is constantly changing. In addition to possible match items process, we would also want

    €431 (Avg Bid)
    €431 Offre moyenne
    28 offres

    Hi, We need 1000 freelancers from Kerala for a Movie related social media campaign. All kerala origin bidders will be awarded if found suitable for the job. Thanks.

    €4 / hr (Avg Bid)
    €4 / hr Offre moyenne
    26 offres

    ...RGB color space Make sure your print file is set to the RGB color space. Include correct inside label info When creating inside labels, include the country of origin, size, and fabric information. This is required by law for all custom inside labels. Outline your fonts All fonts should be converted to outlines unless your graphics

    €26 (Avg Bid)
    Garanti
    €26
    6 propositions